General Information

  • ID:  hor002435
  • Uniprot ID:  A0A3S8RK81(81-90)
  • Protein name:  Myosuppressin
  • Gene name:  NA
  • Organism:  Nezara viridula (Southern green stink bug) (Cimex viridulus)
  • Family:  Myosuppressin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nezara (genus), Pentatominae (subfamily), Pentatomidae (family), Pentatomoidea (superfamily), Pentatomomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  QDLDHVFLRF
  • Length:  10(81-90)
  • Propeptide:  MNFSCVWTVLSAGLIATGALAAPGPDCSPAVLQELPVRVRNMCAALYQFSNALQQYIEENPSYQPIGRDASPIYDSGVKRQDLDHVFLRFGRRR
  • Signal peptide:  MNFSCVWTVLSAGLIATGALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3S8RK81-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002435_AF2.pdbhor002435_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 145018 Formula: C60H88N16O16
Absent amino acids: ACEGIKMNPSTWY Common amino acids: DFL
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 5
Hydrophobicity: -8 Boman Index: -2272
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 107
Instability Index: 4752 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18201800
  • Title:  Comparative Peptidomics of Four Related Hemipteran Species: Pyrokinins, Myosuppressin, Corazonin, Adipokinetic Hormone, sNPF, and Periviscerokinins